LOCUS       NC_012920                346 bp    DNA     linear   PRI 30-APR-2010
DEFINITION  Homo sapiens mitochondrion, complete genome.
ACCESSION   NC_012920 REGION: 10059..10404
VERSION     NC_012920.1  GI:251831106
DBLINK      Project: 30353
            BioProject: PRJNA30353
KEYWORDS    .
SOURCE      mitochondrion Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 346)
  AUTHORS   Andrews,R.M., Kubacka,I., Chinnery,P.F., Lightowlers,R.N.,
            Turnbull,D.M. and Howell,N.
  TITLE     Reanalysis and revision of the Cambridge reference sequence for
            human mitochondrial DNA
  JOURNAL   Nat. Genet. 23 (2), 147 (1999)
   PUBMED   10508508
REFERENCE   2  (bases 1 to 346)
  AUTHORS   Anderson,S., Bankier,A.T., Barrell,B.G., de Bruijn,M.H.,
            Coulson,A.R., Drouin,J., Eperon,I.C., Nierlich,D.P., Roe,B.A.,
            Sanger,F., Schreier,P.H., Smith,A.J., Staden,R. and Young,I.G.
  TITLE     Sequence and organization of the human mitochondrial genome
  JOURNAL   Nature 290 (5806), 457-465 (1981)
   PUBMED   7219534
REFERENCE   3  (bases 1 to 346)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 346)
  AUTHORS   Kogelnik,A.M. and Lott,M.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-AUG-2006) Mitomap.org, Center for Molecular and
            Mitochondrial Medicine and Genetics (MAMMAG) University of
            California, University of California, Irvine, Irvine, CA
            92697-3940, USA
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 346)
  AUTHORS   Kogelnik,A.M. and Lott,M.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-APR-1997) Center for Molecular Medicine, Emory
            University School of Medicine, 1462 Clifton Road, Suite 420,
            Atlanta, GA 30322, USA
  REMARK    sequence updated
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from J01415.
            On Jul 8, 2009 this sequence version replaced gi:115315570.
            This sequence is a corrected version of the HUMMTCG reference
            sequence.  The original Cambridge reference sequence (CRS) is
            preserved as GenBank J01415 gi:337188 [PMID:7219534].  Corrections
            have been made and annotated per the re-sequencing of the original
            material by Andrews et al [PMID:10508508].
            
            This Revised Cambridge Reference Sequence (rCRS) has eighteen
            specific corrections or confirmations of the original 1981 sequence
            of Anderson et al [PMID:7219534].  Seven nucleotides are confirmed
            as rare polymorphisms, maintained as: 263A, 311C-315C, 750A, 1438A,
            4769A, 8860A, and 15326A.  Eleven nucleotides are error
            corrections: 3107del, 3423T, 4985A,  9559C, 11335C, 13702C, 14199T,
            14272C, 14365C, 14368C, and 14766C. These 11 errors in  the
            original Cambridge sequence were determined to be  either outright
            sequencing errors (8 instances) or due to the presence of bovine
            DNA (2 instances) or HeLa DNA (1 instance) mixed in with the
            original human placental DNA [PMID:10508508].  HISTORICAL
            NUCLEOTIDE NUMBERS ARE MAINTAINED by indicating 3107del as 'N'.
            A summary table of the reanalysis data is available online at
            http://www.mitomap.org/MITOMAP/CambridgeReanalysis
            
            L-strand is shown.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..346
                     /organism="Homo sapiens"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /isolation_source="caucasian"
                     /db_xref="taxon:9606"
                     /tissue_type="placenta"
                     /country="United Kingdom: Great Britain"
                     /note="this is the rCRS"
     gene            1..346
                     /gene="ND3"
                     /gene_synonym="MTND3"
                     /nomenclature="Official Symbol: MT-ND3 | Name:
                     mitochondrially encoded NADH dehydrogenase 3 | Provided
                     by: HGNC:7458"
                     /db_xref="GeneID:4537"
                     /db_xref="HGNC:7458"
                     /db_xref="MIM:516002"
     CDS             1..346
                     /gene="ND3"
                     /gene_synonym="MTND3"
                     /note="NADH dehydrogenase, subunit 3 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:346,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 3"
                     /protein_id="YP_003024033.1"
                     /db_xref="GI:251831114"
                     /db_xref="GeneID:4537"
                     /db_xref="HGNC:7458"
                     /db_xref="MIM:516002"
                     /translation="MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPM
                     SPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSL
                     AYEWLQKGLDWTE"
ORIGIN      
        1 ataaacttcg ccttaatttt aataatcaac accctcctag ccttactact aataattatt
       61 acattttgac taccacaact caacggctac atagaaaaat ccacccctta cgagtgcggc
      121 ttcgacccta tatcccccgc ccgcgtccct ttctccataa aattcttctt agtagctatt
      181 accttcttat tatttgatct agaaattgcc ctccttttac ccctaccatg agccctacaa
      241 acaactaacc tgccactaat agttatgtca tccctcttat taatcatcat cctagcccta
      301 agtctggcct atgagtgact acaaaaagga ttagactgaa ccgaat
//